下载

LRRN4 C-terminal like

Cat:P07660

Summary:

【Derived From】: E.coli
【Endotoxin】: Not measured
【Amino Acid】: 1-197aa
【Purity】: ≥85% by SDS-PAGE.
【Name】: LRRN4CL
【Full Name】: LRRN4 C-terminal like
【Uniprot】: Q8ND94
【Gene ID】: 221091
【Mol Mass】: 21kDa
【Application】: Immunology research
【Purification】: NI-NTA affinity purification
【Bioactive】: N0
【Tag】: With a 6×His tag at the N/C-terminus.
【Concentration】: 1mg/ml by SDS-PAGE.

Store:

【Reconstitution】: Reconstituted protein solution can be diluted with distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. (It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water.)
【Storage】: Reconstituted protein solution can be stored at 4-7℃ for 1-2 weeks, stored at < -20℃ for 1 year.
【Formulation】: Powder: Lyophilized from a 0.2 μm filtered solution of 2-8M Urea, 20mM Tris-HCl, 150mM NaCl, 1mM DTT, PH7.2-8.0.

Background:

This antibody was developed against a recombinant protein corresponding to amino acids: QDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCA

Verified picture