[K15,R16,L27]VIP(1-7)/GRF(8-27)
Cat.No:CLP1264 Solarbio
CAS:201995-58-6
Molecular Formula:C142H240N44O38
Molecular Weight:3171.7
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:201995-58-6
Molecular Formula:C142H240N44O38
Molecular Weight:3171.7
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
Product Type | Peptides |
CAS | 201995-58-6 |
Sequence(1LC) | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 |
Sequence(3LC) | His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2 |
Molecular Formula | C142H240N44O38 |
Molecular Weight | 3171.7 |
Purity | ≥95% |
Appearance | Lyophilized powder |
Salt Form | Trifluoroacetate salt |
Source | Synthetic |
Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
Category/Label | Substrate and Enzyme Inhibitors |
Background | [K15,R16,L27]VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively. VIP: VASOACTIVE Intestinal Polypeptide |
Reference | [1]. P Gourlet, et al. Development of high affinity selective VIP1 receptor agonists. Peptides. 1997;18(10):1539-45. |
Unit | Bottle |
Specification | 1mg 5mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.